{"title":"Beach Transfers","description":"","products":[{"product_id":"beach-booze-besties-ready-to-press-sublimation-transfer","title":"Beach Booze Besties Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":32402219368508,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":32402219401276,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":32402219434044,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":32402219466812,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":32402219499580,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":32402219532348,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachesboozeandbestieswm.jpg?v=1596828855"},{"product_id":"salt-in-the-air-sand-in-my-hair-ready-to-press-sublimation-transfer","title":"Salt in the Air Sand in my Hair Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":32402241585212,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":32402241617980,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":32402241650748,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":32402241683516,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":32402241716284,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":32402241749052,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/SaltInTheAirSandInMyHairwm.jpg?v=1596830520"},{"product_id":"high-tides-good-vibes-ready-to-press-sublimation-transfer","title":"High Tides Good Vibes Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39287820910652,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39287820943420,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39287820976188,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39287821008956,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39287821041724,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39287821074492,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/hightidesgoodvibeswm.jpg?v=1616802423"},{"product_id":"hope-anchors-my-soul-ready-to-press-sublimation-transfer","title":"Hope Anchors My Soul Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39287822614588,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39287822647356,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39287822680124,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39287822712892,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39287822745660,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39287822778428,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/hopeanchorsmysoulwm.jpg?v=1616802586"},{"product_id":"lets-get-salty-ready-to-press-sublimation-transfer","title":"Let's Get Salty Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39287860822076,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39287860854844,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39287860887612,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39287860953148,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39287860985916,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39287861018684,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/let_sgetsaltywm.jpg?v=1616803832"},{"product_id":"beach-life-ready-to-press-sublimation-transfer","title":"Beach Life Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39335621263420,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39335621296188,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39335621328956,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39335621361724,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39335621394492,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39335621427260,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachlifemockup.jpg?v=1620085805"},{"product_id":"beach-bum-ready-to-press-sublimation-transfer","title":"Beach Bum Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39352436523068,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39352436555836,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39352436588604,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39352436621372,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39352436654140,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39352436686908,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbumwm.jpg?v=1628753207"},{"product_id":"beach-vibes-ready-to-press-sublimation-transfer","title":"Beach Vibes Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39355566325820,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39355566358588,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39355566391356,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39355566424124,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39355566456892,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39355566489660,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/BEACHVIBESWM.jpg?v=1621548255"},{"product_id":"beach-please-ready-to-press-sublimation-transfer","title":"Beach Please Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39382462398524,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39382462431292,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39382462464060,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39382462496828,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39382462529596,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39382462562364,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachpleasewm.png?v=1623286730"},{"product_id":"salty-hair-dont-care-ready-to-press-sublimation-transfer","title":"Salty Hair Don't Care Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39390122606652,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39390122639420,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39390122672188,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39390122704956,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39390122737724,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39390122770492,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltyhairwm.jpg?v=1623797361"},{"product_id":"salty-vibes-ready-to-press-sublimation-transfer","title":"Salty Vibes Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39390124277820,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39390124310588,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39390124343356,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39390124376124,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39390124408892,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39390124441660,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltyvibeswm.jpg?v=1623797414"},{"product_id":"boat-waves-sun-rays-beach-days-ready-to-press-sublimation-transfer","title":"Boat Waves Sun Rays Beach Days Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39393080737852,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39393080770620,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39393080803388,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39393080836156,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39393080868924,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39393080901692,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/boatwavessunraysbeachdayswm.png?v=1624041821"},{"product_id":"boat-waves-sun-rays-ready-to-press-sublimation-transfer","title":"Boat Waves Sun Rays Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39410084118588,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39410084151356,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39410084184124,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39410084216892,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39410084249660,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39410084282428,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/boatwavessunraysbeachdayswm.jpg?v=1625171258"},{"product_id":"beach-bound-ready-to-press-sublimation-transfer","title":"Beach Bound Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39411348242492,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39411348275260,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39411348308028,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39411348340796,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39411348373564,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39411348406332,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachboundwm.jpg?v=1625258307"},{"product_id":"beach-life-ready-to-press-sublimation-transfer-1","title":"Beach Life Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39411348799548,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39411348832316,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39411348865084,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39411348897852,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39411348930620,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39411348963388,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachlifewm.jpg?v=1625258421"},{"product_id":"beach-more-less-worry-ready-to-press-sublimation-transfer","title":"Beach More Worry Less Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39411349356604,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39411349389372,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39411349422140,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39411349454908,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39411349487676,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39411349520444,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachmoreworrylesswm.jpg?v=1625258505"},{"product_id":"beach-please-ready-to-press-sublimation-transfer-1","title":"Beach Please Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39411349684284,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39411349717052,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39411349749820,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39411349782588,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39411349815356,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39411349848124,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachpleasepinkorangewm.jpg?v=1625258563"},{"product_id":"beach-vibes-ready-to-press-sublimation-transfer-1","title":"Beach Vibes Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39411350175804,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39411350208572,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39411350241340,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39411350274108,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39411350306876,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39411350339644,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachvibespalmtreeswm.jpg?v=1625258620"},{"product_id":"beach-vibes-leopard-ready-to-press-sublimation-transfer","title":"Beach Vibes Leopard Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39411350372412,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39411350405180,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39411350437948,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39411350470716,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39411350503484,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39411350536252,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachvibeswm_4140af9e-15e2-4900-8686-3fcfde08500c.jpg?v=1625258672"},{"product_id":"dont-be-a-shady-beach-ready-to-press-sublimation-transfer","title":"Don't be a Shady Beach Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39411374850108,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39411374882876,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39411374915644,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39411374948412,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39411374981180,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39411375013948,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/dontbeashadybeachwm.jpg?v=1625262905"},{"product_id":"go-with-the-flow-ready-to-press-sublimation-transfer","title":"Go with the Flow Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39411386908732,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39411386941500,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39411386974268,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39411387007036,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39411387039804,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39411387072572,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/gowiththeflowwm.jpg?v=1625265556"},{"product_id":"beach-mode-ready-to-press-sublimation-transfer","title":"Beach Mode Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39434074521660,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39434074554428,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39434074587196,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39434074619964,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39434074652732,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39434074685500,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachmodewm.jpg?v=1627433425"},{"product_id":"save-the-turtles-ready-to-press-sublimation-transfer","title":"Save The Turtles Ready To Press Sublimation Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39434144972860,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39434145005628,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39434145038396,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39434145071164,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39434145103932,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39434145136700,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/savetheturtleswm.jpg?v=1627442090"},{"product_id":"the-only-bs-i-need-is-beaches-and-sunshine-ready-to-press-sublimation-and-dtf-transfer","title":"The only BS I need is Beaches and Sunshine Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39452797370428,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39452797403196,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39452797435964,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39452797468732,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39452797501500,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39452797534268,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/theonlybsineedisbeerandsunshine2wm.jpg?v=1628735437"},{"product_id":"beach-bum-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Bum Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39452822995004,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39452823027772,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39452823060540,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39452823093308,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39452823126076,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39452823158844,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbum2wm.jpg?v=1628740240"},{"product_id":"salty-lil-beach-ready-to-press-sublimation-and-dtf-transfer","title":"Salty Lil Beach Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39452907438140,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39452907470908,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39452907503676,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39452907536444,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39452907569212,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39452907601980,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltylilbeachwm.jpg?v=1628752160"},{"product_id":"sunrise-sunburn-sunset-ready-to-press-sublimation-and-dtf-transfer","title":"Sunrise Sunburn Sunset Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39454619729980,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39454619762748,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39454619795516,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39454619828284,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39454619861052,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39454619893820,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/sunrisesunburnsunsetrepeat2wm.jpg?v=1628876932"},{"product_id":"sunrise-sunburn-sunset-rainbow-ready-to-press-sublimation-and-dtf-transfer","title":"Sunrise Sunburn Sunset Rainbow Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39454620876860,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39454620909628,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39454620942396,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39454620975164,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39454621007932,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39454621040700,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/sunrisesunburnsunsetrepeatwm.jpg?v=1628877004"},{"product_id":"tanned-and-tipsy-ready-to-press-sublimation-and-dtf-transfer","title":"Tanned and Tipsy Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39454621925436,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39454621958204,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39454621990972,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39454622023740,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39454622056508,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39454622089276,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/tannedandtipsywm.jpg?v=1628877049"},{"product_id":"beach-please-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Please Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39454663770172,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39454663802940,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39454663835708,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39454663868476,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39454663901244,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39454663934012,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachplease2wm.jpg?v=1628878799"},{"product_id":"summer-vibes-ready-to-press-sublimation-and-dtf-transfer-1","title":"Summer Vibes Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39454840979516,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39454841012284,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39454841045052,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39454841077820,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39454841110588,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39454841143356,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summervibesgreentoyellowwm.jpg?v=1628882728"},{"product_id":"summer-vibes-sunset-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Vibes Sunset Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39454842388540,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39454842421308,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39454842454076,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39454842486844,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39454842519612,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39454842552380,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summervibessunsetcolorswm.jpg?v=1628882799"},{"product_id":"summer-vibes-teal-pink-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Vibes Teal\/Pink Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39454844977212,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39454845009980,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39454845042748,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39454845075516,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39454845108284,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39454845141052,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summervibestealtopinkwm.jpg?v=1628882997"},{"product_id":"all-i-need-is-vitamin-sea-ready-to-press-sublimation-and-dtf-transfer","title":"All I Need is Vitamin Sea Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39458619949116,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39458619981884,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39458620014652,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39458620047420,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39458620080188,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39458620112956,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/allIneedisvitaminseawm.jpg?v=1629221914"},{"product_id":"be-your-own-kind-of-mermaid-ready-to-press-sublimation-and-dtf-transfer","title":"Be Your Own Kind of Mermaid Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39458652454972,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39458652487740,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39458652520508,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39458652553276,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39458652586044,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39458652618812,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beyourownkindofmermaidwm.jpg?v=1629224711"},{"product_id":"beach-mode-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Mode Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39458654748732,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39458654781500,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39458654814268,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39458654847036,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39458654879804,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39458654912572,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachmodewm_59c0ec34-adc5-4666-ac24-f48c874a90b3.jpg?v=1629224899"},{"product_id":"beach-vibes-purple-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Vibes Purple Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39458656092220,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39458656124988,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39458656157756,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39458656190524,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39458656223292,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39458656256060,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachvibespurplewm.jpg?v=1629225205"},{"product_id":"beach-vibes-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Vibes Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39458657173564,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39458657206332,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39458657239100,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39458657271868,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39458657304636,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39458657337404,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachvibeswm.png?v=1629225253"},{"product_id":"life-is-better-at-the-beach-ready-to-press-sublimation-and-dtf-transfer","title":"Life Is Better At The Beach Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460027400252,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460027433020,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460027465788,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460027498556,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460027531324,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460027564092,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/lifeisbetteratthebeachwm.png?v=1629303461"},{"product_id":"life-is-better-in-flip-flops-ready-to-press-sublimation-and-dtf-transfer","title":"Life is Better In Flip Flops Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460027760700,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460027793468,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460027826236,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460027859004,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460027891772,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460027924540,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/lifeisbetterinflipflopswm.jpg?v=1629303525"},{"product_id":"salt-water-heals-everything-ready-to-press-sublimation-and-dtf-transfer","title":"Salt Water Heals Everything Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460073603132,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460073635900,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460073668668,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460073701436,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460073734204,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460073766972,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltwaterhealseverythingwm.png?v=1629310099"},{"product_id":"salty-lil-beach-ready-to-press-sublimation-and-dtf-transfer-1","title":"Salty Lil Beach Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460074815548,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460074848316,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460074881084,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460074913852,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460074946620,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460074979388,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltylilbeachwm_491a003d-21de-418d-8e9a-ce511503d347.jpg?v=1629310153"},{"product_id":"sky-above-sand-below-peace-within-ready-to-press-sublimation-and-dtf-transfer","title":"Sky Above Sand Below Peace Within Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460078616636,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460078649404,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460078682172,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460078714940,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460078747708,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460078780476,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/skyabovesandbelowpeacewithinwm.jpg?v=1629310410"},{"product_id":"summer-dreams-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Dreams Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460103520316,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460103553084,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460103585852,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460103618620,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460103651388,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460103684156,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summerdreamswm.jpg?v=1629311113"},{"product_id":"summer-nights-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Nights Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460107681852,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460107714620,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460107747388,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460107780156,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460107812924,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460107845692,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summernightswm.png?v=1629311213"},{"product_id":"summer-vibes-sunset-ready-to-press-sublimation-and-dtf-transfer-1","title":"Summer Vibes Sunset Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460109484092,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460109516860,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460109549628,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460109582396,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460109615164,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460109647932,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summervibessunsetwm.jpg?v=1629311260"},{"product_id":"summer-vibes-surfing-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Vibes Surfing Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460112367676,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460112400444,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460112433212,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460112465980,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460112498748,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460112531516,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summervibessurfingwm.jpg?v=1629311298"},{"product_id":"summer-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460115710012,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460115742780,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460115775548,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460115808316,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460115841084,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460115873852,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summerwm.jpg?v=1629311335"},{"product_id":"sunrise-sunburn-sunset-repeat-ready-to-press-sublimation-and-dtf-transfer","title":"Sunrise Sunburn Sunset Repeat Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460118167612,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460118200380,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460118233148,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460118265916,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460118298684,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460118331452,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/sunrisesunburnsunsetrepeat2wm_574f341b-54fc-4a3d-8811-9da130443285.jpg?v=1629311396"},{"product_id":"sunrise-sunburn-sunset-repeat-watercolor-ready-to-press-sublimation-and-dtf-transfer","title":"Sunrise Sunburn Sunset Repeat Watercolor Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460120363068,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460120395836,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460120428604,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460120461372,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460120494140,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460120526908,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/sunrisesunburnsunsetrepeatwm.png?v=1629311491"},{"product_id":"sunshine-and-tan-lines-watercolor-ready-to-press-sublimation-and-dtf-transfer","title":"Sunshine and Tan Lines Watercolor Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460120854588,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460120887356,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460120920124,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460120952892,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460120985660,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460121018428,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/sunshineandtanlineswatercolorwm.png?v=1629311561"},{"product_id":"take-me-to-the-beach-sunset-ready-to-press-sublimation-and-dtf-transfer","title":"Take Me To The Beach | Sunset Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460128653372,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460128686140,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460128718908,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460128751676,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460128784444,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460128817212,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/takemetothebeachsunsetwm.jpg?v=1629311936"},{"product_id":"take-me-to-the-beach-ready-to-press-sublimation-and-dtf-transfer","title":"Take Me To The Beach Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460128915516,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460128948284,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460128981052,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460129013820,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460129046588,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460129079356,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/takemetothebeachwm.jpg?v=1629311998"},{"product_id":"tequila-lime-and-sunshine-ready-to-press-sublimation-and-dtf-transfer","title":"Tequila Lime and Sunshine Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460130947132,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460130979900,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460131012668,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460131045436,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460131078204,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460131110972,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/tequilalimeandsunshinewm_d1da44cf-4ced-4389-9333-433fc0d2a9ed.jpg?v=1629312097"},{"product_id":"the-beach-is-my-happy-place-ready-to-press-sublimation-and-dtf-transfer","title":"The Beach Is My Happy Place Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39460131635260,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39460131668028,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39460131700796,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39460131733564,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39460131766332,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39460131799100,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/thebeachismyhappyplacewm.jpg?v=1629312191"},{"product_id":"beachy-babe-ready-to-press-sublimation-and-dtf-transfer","title":"Beachy Babe Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39462935035964,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39462935068732,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39462935101500,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39462935134268,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39462935167036,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39462935199804,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachybabewm.jpg?v=1629495480"},{"product_id":"beachy-mama-ready-to-press-sublimation-and-dtf-transfer","title":"Beachy Mama Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39462935363644,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39462935396412,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39462935429180,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39462935461948,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39462935494716,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39462935527484,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachymamawm.jpg?v=1629495551"},{"product_id":"aloha-beaches-ready-to-press-sublimation-and-dtf-transfer","title":"Aloha beaches Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39464104493116,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39464104525884,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39464104558652,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39464104591420,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39464104624188,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39464104656956,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/alohabeacheswm_144caa6f-b96c-4dca-a45e-242414194d7a.jpg?v=1629612589"},{"product_id":"vacay-mode-ready-to-press-sublimation-and-dtf-transfer","title":"Vacay mode Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e DTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 312 degrees for 12 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 12 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.SIZINGMug: 3-4 inches wide\/heightInfant: 5-6 inches wide\/heightToddler: 7-8 inches wide\/heightYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)Adult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)ALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***You can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.BULK ORDER PRICING NOW AVAILABLE!For those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:-25 to 60 transfers 10% off use code BULK1-61 to 99 transfers 15% off use code BULK2-100+ transfers 20% off use code BULK3GANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGEIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39464105082940,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39464105115708,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39464105148476,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39464105181244,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39464105214012,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39464105246780,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/vacaymodewm.jpg?v=1629612620"},{"product_id":"beaching-not-teaching-ready-to-press-sublimation-and-dtf-transfer","title":"Beaching Not Teaching Ready To Press Sublimation and DTF Transfer","description":"\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39475275202620,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39475275235388,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39475275268156,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39475275300924,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39475275333692,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39475275366460,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachingnotteachingwm.jpg?v=1630423884"},{"product_id":"beach-babe-palm-trees-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Babe Palm Trees Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486180261948,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486180294716,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486180327484,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486180360252,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486180393020,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486180425788,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbabeptwm.jpg?v=1631210494"},{"product_id":"beach-babe-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Babe Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486180556860,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486180589628,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486180622396,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486180655164,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486180687932,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486180720700,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbabewm.jpg?v=1631210549"},{"product_id":"beach-bum-black-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Bum Black Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486181507132,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486181572668,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486181638204,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486181736508,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486181769276,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486181802044,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbumblackwm.jpg?v=1631210596"},{"product_id":"beach-bum-palm-trees-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Bum Palm Trees Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486182948924,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486182981692,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486183014460,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486183047228,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486183079996,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486183112764,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbumptwm.jpg?v=1631210647"},{"product_id":"beach-bum-waves-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Bum Waves Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486183931964,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486183964732,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486183997500,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486184030268,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486184063036,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486184095804,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbumwaveswm.jpg?v=1631210685"},{"product_id":"beach-bum-ready-to-press-sublimation-and-dtf-transfer-1","title":"Beach Bum Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486184849468,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486184882236,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486184915004,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486184947772,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486184980540,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486185013308,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbumwm_5cabd3d3-a302-4efe-a22f-957cf81c39d7.jpg?v=1631210718"},{"product_id":"beach-please-black-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Please Black Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486185603132,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486185635900,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486185668668,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486185701436,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486185734204,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486185766972,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachpleaseblackwm.jpg?v=1631210768"},{"product_id":"beach-please-ready-to-press-sublimation-and-dtf-transfer-1","title":"Beach Please Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486186618940,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486186651708,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486186684476,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486186717244,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486186750012,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486186782780,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachpleasewm.jpg?v=1631210806"},{"product_id":"hello-summer-black-ready-to-press-sublimation-and-dtf-transfer","title":"Hello Summer Black Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486208639036,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486208671804,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486208704572,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486208737340,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486208770108,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486208802876,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/hellosummerblackwm.jpg?v=1631212829"},{"product_id":"hello-summer-sunglasses-ready-to-press-sublimation-and-dtf-transfer","title":"Hello Summer Sunglasses Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486210113596,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486210146364,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486210179132,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486210211900,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486210244668,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486210277436,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/hellosummersgwm.jpg?v=1631212985"},{"product_id":"beach-babe-ready-to-press-sublimation-and-dtf-transfer-1","title":"Beach Babe Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486598905916,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486598938684,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486598971452,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486599004220,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486599036988,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486599069756,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbabewm_801d2565-bb96-4f72-8475-75b3ce6dceed.jpg?v=1631236135"},{"product_id":"beach-please-ready-to-press-sublimation-and-dtf-transfer-2","title":"Beach Please Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39486601166908,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39486601199676,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39486601232444,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39486601265212,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39486601297980,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39486601330748,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachpleasewm_95e436d5-977f-407c-9831-405017a2e663.jpg?v=1631236200"},{"product_id":"feeling-beachy-ready-to-press-sublimation-and-dtf-transfer","title":"Feeling Beachy Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39487379144764,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39487379177532,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39487379210300,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39487379243068,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39487379275836,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39487379308604,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/feelingbeachywm.jpg?v=1631291693"},{"product_id":"home-is-where-the-waves-are-ready-to-press-sublimation-and-dtf-transfer","title":"Home Is Where The Waves Are Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39487542100028,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39487542132796,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39487542165564,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39487542198332,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39487542231100,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39487542263868,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/homeiswherethewavesarewm.jpg?v=1631304128"},{"product_id":"salt-water-heals-everything-ready-to-press-sublimation-and-dtf-transfer-1","title":"Salt Water Heals Everything Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39491377954876,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39491377987644,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39491378020412,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39491378053180,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39491378085948,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39491378118716,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltwaterhealseverythingwm.jpg?v=1631572153"},{"product_id":"salty-soul-ready-to-press-sublimation-and-dtf-transfer","title":"Salty Soul Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39491381854268,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39491381887036,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39491381919804,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39491381952572,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39491381985340,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39491382018108,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltysoulwm.jpg?v=1631572259"},{"product_id":"certified-creep-ready-to-press-sublimation-and-dtf-transfer-1","title":"Certified creep Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":40011376590908,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":40011376656444,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":40011376721980,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":40011376787516,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":40011376853052,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":40011376918588,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":40011376984124,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/certifiedcreep2wm.jpg?v=1633470055"},{"product_id":"salty-lil-beach-2-ready-to-press-sublimation-and-dtf-transfer","title":"Salty Lil Beach | 2 Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39517417078844,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39517417111612,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39517417144380,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39517417177148,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39517417209916,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39517417242684,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltylilbeach2wm.jpg?v=1633543408"},{"product_id":"live-life-simply-beach-chairs-umbrella-ready-to-press-sublimation-and-dtf-transfer","title":"Live Life Simply Beach Chairs\/Umbrella Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39517870325820,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39517870358588,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39517870391356,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39517870424124,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39517870456892,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39517870489660,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/livelifesimplybeachchairsumbrellawm.png?v=1633556455"},{"product_id":"southern-girl-charm-come-sail-away-with-me-ready-to-press-sublimation-and-dtf-transfer","title":"Southern Girl Charm Come Sail Away With Me Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39518036656188,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39518036688956,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39518036721724,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39518036754492,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39518036787260,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39518036820028,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/southerngirlcharmcomesailawaywithmewm.png?v=1633564049"},{"product_id":"beach-life-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Life Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39527384547388,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39527384580156,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39527384612924,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39527384645692,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39527384678460,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39527384711228,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachlifewm.png?v=1633987664"},{"product_id":"beach-vibes-tiedye-sunglasses-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Vibes Tiedye Sunglasses Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39527384907836,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39527384940604,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39527384973372,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39527385006140,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39527385038908,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39527385071676,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachvibestiedyesunglasseswm.png?v=1633987732"},{"product_id":"changes-in-latitude-changes-in-attitude-2-ready-to-press-sublimation-and-dtf-transfer","title":"Changes In Latitude Changes In Attitude 2  Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39527391264828,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39527391297596,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39527391330364,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39527391363132,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39527391395900,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39527391428668,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/changesinlatitudechangesinattitude2wm.png?v=1633988454"},{"product_id":"changes-in-latitude-changes-in-attitude-beach-island-ready-to-press-sublimation-and-dtf-transfer","title":"Changes In Latitude Changes In Attitude Beach Island Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39527392149564,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39527392182332,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39527392215100,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39527392247868,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39527392280636,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39527392313404,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/changesinlatitudechangesinattitudebeachislandwm.png?v=1633988682"},{"product_id":"find-me-under-the-palms-ready-to-press-sublimation-and-dtf-transfer","title":"Find Me Under The Palms Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39527411744828,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39527411777596,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39527411810364,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39527411843132,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39527411875900,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39527411908668,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/findmeunderthepalmswm.png?v=1633989868"},{"product_id":"into-the-deep-astronaut-ready-to-press-sublimation-and-dtf-transfer","title":"Into The Deep Astronaut Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":39802157039676,"sku":null,"price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":39802157072444,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":39802157105212,"sku":null,"price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":39802157137980,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":39802157170748,"sku":null,"price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":39802157203516,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":39802157236284,"sku":null,"price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":39802157269052,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":39802157301820,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":39802157334588,"sku":null,"price":5.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":39802157367356,"sku":null,"price":3.25,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":39802157400124,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":39802157432892,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":39802157465660,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/intothedeepastronautwm.png?v=1634003200"},{"product_id":"just-go-with-the-flow-seat-turtle-ready-to-press-sublimation-and-dtf-transfer","title":"Just Go With The Flow Seat Turtle Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39527770816572,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39527770849340,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39527770882108,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39527770914876,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39527770947644,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39527770980412,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/justgowiththeflowseaturtlewm.png?v=1634003316"},{"product_id":"just-keep-swimming-preppy-fish-ready-to-press-sublimation-and-dtf-transfer","title":"Just Keep Swimming Preppy Fish Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39527777239100,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39527777271868,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39527777304636,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39527777337404,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39527777370172,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39527777402940,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/justkeepswimmingpreppyfishwm.png?v=1634003537"},{"product_id":"lifes-a-beach-enjoy-the-waves-ready-to-press-sublimation-and-dtf-transfer","title":"Life's A Beach Enjoy The Waves Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39527802044476,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39527802077244,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39527802110012,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39527802142780,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39527802175548,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39527802208316,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/lifesabeachenjoythewaveswm.png?v=1634003968"},{"product_id":"salty-beach-blue-ready-to-press-sublimation-and-dtf-transfer","title":"Salty Beach | Blue Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39527857487932,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39527857520700,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39527857553468,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39527857586236,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39527857619004,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39527857651772,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltybeachbluewm.png?v=1634005441"},{"product_id":"salty-beach-pink-ready-to-press-sublimation-and-dtf-transfer","title":"Salty Beach | Pink Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39527857717308,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39527857750076,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39527857782844,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39527857815612,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39527857848380,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39527857881148,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltybeachpinkwm.png?v=1634005499"},{"product_id":"salty-beach-purple-ready-to-press-sublimation-and-dtf-transfer","title":"Salty Beach | Purple Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39527858798652,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39527858831420,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39527858864188,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39527858896956,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39527858929724,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39527858962492,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltybeachpurplewm.png?v=1634005639"},{"product_id":"southern-girl-charm-toes-in-the-sand-ready-to-press-sublimation-and-dtf-transfer","title":"Southern Girl Charm Toes In The Sand Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39528474935356,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39528474968124,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39528475000892,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39528475033660,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39528475066428,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39528475099196,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/southerngirlcharmtoesinthesandwm.png?v=1634051760"},{"product_id":"sun-kissed-ready-to-press-sublimation-and-dtf-transfer","title":"Sun Kissed Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39528484503612,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39528484536380,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39528484569148,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39528484601916,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39528484634684,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39528484667452,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/sunkissedwm_f137bea0-5a92-43c2-92f7-d5302f2d193f.png?v=1634052491"},{"product_id":"tropic-like-its-hot-summer-palm-tree-surf-ready-to-press-sublimation-and-dtf-transfer","title":"Tropic Like It's Hot Summer Palm Tree Surf Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39528531722300,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39528531755068,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39528531787836,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39528531820604,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39528531853372,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39528531886140,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/tropiclikeitshotsummerpalmtreesurfwm.png?v=1634055035"},{"product_id":"beach-bum-sun-leopard-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Bum | Sun Leopard Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39530206330940,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39530206363708,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39530206396476,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39530206429244,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39530206462012,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39530206494780,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbumleopardsummersunbeachchaircoconutdrinkwm.png?v=1634136614"},{"product_id":"crab-island-paradise-beach-variety-colors-ready-to-press-sublimation-and-dtf-transfer","title":"Crab Island Paradise Beach | Variety Colors Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39530211049532,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39530211082300,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39530211115068,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39530211147836,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39530211180604,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39530211213372,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/crabislandparadisebeachvarietycolorswm.png?v=1634136968"},{"product_id":"goodbye-teaching-hello-beaching-leopard-sun-summer-break-ready-to-press-sublimation-and-dtf-transfer","title":"Goodbye Teaching Hello Beaching | Leopard Sun Summer Break Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39530228842556,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39530228875324,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39530228908092,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39530228940860,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39530228973628,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39530229006396,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/goodbyeteachinghellobeachingleopardsunsummerbreakwm.png?v=1634138494"},{"product_id":"marco-island-orange-ready-to-press-sublimation-and-dtf-transfer","title":"Marco Island | Orange Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39530259677244,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39530259742780,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39530259841084,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39530259906620,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39530260004924,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39530260070460,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/marcoislandorangewm.png?v=1634140399"},{"product_id":"marco-island-pink-ready-to-press-sublimation-and-dtf-transfer","title":"Marco Island | Pink Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39530260856892,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39530260889660,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39530260922428,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39530260955196,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39530260987964,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39530261020732,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/marcoislandpinkwm.png?v=1634140436"},{"product_id":"marco-island-purple-ready-to-press-sublimation-and-dtf-transfer","title":"Marco Island | Purple Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39530268753980,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39530268786748,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39530268819516,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39530268852284,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39530268885052,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39530268917820,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/marcoislandpurplewm.png?v=1634141199"},{"product_id":"marco-island-teal-ready-to-press-sublimation-and-dtf-transfer","title":"Marco Island | Teal Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39530269507644,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39530269540412,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39530269573180,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39530269605948,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39530269638716,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39530269671484,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/marcoislandtealwm.png?v=1634141249"},{"product_id":"quitting-everything-to-be-a-mermaid-sea-shell-ready-to-press-sublimation-and-dtf-transfer","title":"Quitting Everything To Be A Mermaid Sea Shell Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39530346938428,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39530346971196,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39530347003964,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39530347036732,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39530347069500,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39530347102268,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/quittingeverythingtobeamermaidseashellwm.png?v=1634148075"},{"product_id":"take-me-to-the-beach-please-mermaid-leopard-sea-shell-ready-to-press-sublimation-and-dtf-transfer","title":"Take Me To The Beach Please | Mermaid Leopard Sea Shell Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39530352902204,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39530352934972,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39530352967740,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39530353000508,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39530353033276,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39530353066044,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/takemetothebeachpleasemermaidleopardseashellwm.png?v=1634148669"},{"product_id":"i-followed-my-heart-and-it-led-me-to-the-beach-ready-to-press-sublimation-and-dtf-transfer","title":"I followed my heart and it led me to the beach Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39533925695548,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39533925728316,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39533925761084,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39533925793852,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39533925826620,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39533925859388,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/ifollowedmyheartanditleadmetothebeachwm.jpg?v=1634333307"},{"product_id":"rad-dad-skeleton-surfer-variety-ready-to-press-sublimation-and-dtf-transfer","title":"Rad Dad Skeleton Surfer | Variety Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation \/ Teal\/Orange","offer_id":39802193543228,"sku":null,"price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ Sublimation \/ Orange\/Purple","offer_id":39898349273148,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ Sublimation \/ Pink\/Teal","offer_id":39898349305916,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF \/ Teal\/Orange","offer_id":39802193575996,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF \/ Orange\/Purple","offer_id":39898349338684,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF \/ Pink\/Teal","offer_id":39898349371452,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation \/ Teal\/Orange","offer_id":39802193608764,"sku":null,"price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation \/ Orange\/Purple","offer_id":39898349404220,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation \/ Pink\/Teal","offer_id":39898349436988,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF \/ Teal\/Orange","offer_id":39802193641532,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF \/ Orange\/Purple","offer_id":39898349469756,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF \/ Pink\/Teal","offer_id":39898349502524,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation \/ Teal\/Orange","offer_id":39802193674300,"sku":null,"price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation \/ Orange\/Purple","offer_id":39898349535292,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation \/ Pink\/Teal","offer_id":39898349568060,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF \/ Teal\/Orange","offer_id":39802193707068,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF \/ Orange\/Purple","offer_id":39898349600828,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF \/ Pink\/Teal","offer_id":39898349633596,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation \/ Teal\/Orange","offer_id":39802193739836,"sku":null,"price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation \/ Orange\/Purple","offer_id":39898349666364,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation \/ Pink\/Teal","offer_id":39898349699132,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF \/ Teal\/Orange","offer_id":39802193772604,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF \/ Orange\/Purple","offer_id":39898349731900,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF \/ Pink\/Teal","offer_id":39898349764668,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation \/ Teal\/Orange","offer_id":39802193805372,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation \/ Orange\/Purple","offer_id":39898349797436,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation \/ Pink\/Teal","offer_id":39898349830204,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF \/ Teal\/Orange","offer_id":39802193838140,"sku":null,"price":5.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF \/ Orange\/Purple","offer_id":39898349862972,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF \/ Pink\/Teal","offer_id":39898349895740,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation \/ Teal\/Orange","offer_id":39802193870908,"sku":null,"price":3.25,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation \/ Orange\/Purple","offer_id":39898349928508,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation \/ Pink\/Teal","offer_id":39898349961276,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF \/ Teal\/Orange","offer_id":39802193903676,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF \/ Orange\/Purple","offer_id":39898349994044,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF \/ Pink\/Teal","offer_id":39898350026812,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation \/ Teal\/Orange","offer_id":39802193936444,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation \/ Orange\/Purple","offer_id":39898350059580,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation \/ Pink\/Teal","offer_id":39898350092348,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF \/ Teal\/Orange","offer_id":39802193969212,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF \/ Orange\/Purple","offer_id":39898350125116,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF \/ Pink\/Teal","offer_id":39898350157884,"sku":"","price":2.75,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/raddadskeletonsurfervarietywm.png?v=1635265797"},{"product_id":"shark-attack-ready-to-press-sublimation-and-dtf-transfer","title":"Shark Attack Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester.  If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash.  Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash.  It is suggested to press at 385 degrees with light pressure for approximately 45 seconds.  Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process.  It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment.  Transfers will come printed reverse.  \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film.  The design is able to be applied to almost any substrate\/material.  Also, these transfers can go on any color item.  Unlike sublimation this process DOES print white.  The process is rather simple.  To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure.  Set item aside and let cool.  Once cool peel the film and repress with teflon sheet for 8 seconds.  You want to see the texture of the shirt.  With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready!  A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day.  Sometimes I am able to ship out same day depending on the time the order is placed.  \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another).  Production days will be every Tuesday and Friday.  All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list.  I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing.  There is a minimum of 25 transfers to qualify for bulk order pricing.  The bulk pricing will provide a percentage off your order total (not total with tax and shipping).  The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eSIZING \u003cbr data-mce-fragment=\"1\"\u003eMug: 3-4 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eInfant: 5-6 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eToddler: 7-8 inches wide\/height\u003cbr data-mce-fragment=\"1\"\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr data-mce-fragment=\"1\"\u003eAdult large: 12-15 inches wide (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr data-mce-fragment=\"1\"\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH and paper sizing only pertains to sublimation not DTF\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBULK ORDER PRICING NOW AVAILABLE! \u003cbr data-mce-fragment=\"1\"\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr data-mce-fragment=\"1\"\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr data-mce-fragment=\"1\"\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr data-mce-fragment=\"1\"\u003e-100+ transfers 20% off use code BULK3\u003cbr data-mce-fragment=\"1\"\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr data-mce-fragment=\"1\"\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39626793254972,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39626793287740,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39626793320508,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39626793353276,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39626793386044,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39626793418812,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/sharkattackwmSD.jpg?v=1637769707"},{"product_id":"tropical-floral-mama-ready-to-press-sublimation-and-dtf-transfer","title":"Tropical Floral Mama Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39647612076092,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39647612108860,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39647612141628,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39647612174396,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39647612207164,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39647612239932,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/tropicalfloralmamawmSD.jpg?v=1638375082"},{"product_id":"tropical-vibes-ready-to-press-sublimation-and-dtf-transfer","title":"Tropical Vibes Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39647617843260,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39647617876028,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39647617908796,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39647617941564,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39647617974332,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39647618007100,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/tropicalvibeswmSD.jpg?v=1638375272"},{"product_id":"wifi-is-weak-and-rum-is-strong-2-ready-to-press-sublimation-and-dtf-transfer","title":"Wifi Is Weak And Rum is Strong | 2 Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39647715131452,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39647715164220,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39647715196988,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39647715229756,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39647715262524,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39647715295292,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/wifiisweakandrumisstrong2wmSD.jpg?v=1638378915"},{"product_id":"wifi-is-weak-and-rum-is-strong-ready-to-press-sublimation-and-dtf-transfer","title":"Wifi Is Weak And Rum is Strong Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39647716737084,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39647716769852,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39647716802620,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39647716835388,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39647716868156,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39647716900924,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/wifiisweakandrumisstrongwmSD.jpg?v=1638379056"},{"product_id":"salty-little-beach-messy-bun-ready-to-press-sublimation-and-dtf-transfer","title":"Salty Little Beach Messy Bun Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39716667850812,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39716667883580,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39716667916348,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39716667949116,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39716667981884,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39716668014652,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltylilbeachmessybunwm.jpg?v=1640722623"},{"product_id":"be-unique-nautical-rainbow-ready-to-press-sublimation-and-dtf-transfer","title":"Be Unique Nautical Rainbow Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39723913084988,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39723913117756,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39723913150524,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39723913183292,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39723913216060,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39723913248828,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beuniquewm.jpg?v=1641074450"},{"product_id":"anti-social-mermaid-ready-to-press-sublimation-and-dtf-transfer","title":"Anti Social Mermaid Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39808000065596,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39808000098364,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39808000131132,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39808000163900,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39808000196668,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39808000229436,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/antisocialmermaidwmSD.jpg?v=1643833144"},{"product_id":"be-unique-ready-to-press-sublimation-and-dtf-transfer-2","title":"Be Unique Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39826536988732,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39826537021500,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39826537054268,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39826537087036,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39826537119804,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39826537152572,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beuniquewmsimplysmooth_1dbc691d-73d2-4813-81d3-d9c0020619af.jpg?v=1644425694"},{"product_id":"i-was-made-for-sunny-days-ready-to-press-sublimation-and-dtf-transfer","title":"I Was Made for Sunny Days Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39833469911100,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39833469943868,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39833469976636,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39833470009404,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39833470042172,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39833470074940,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/iwasmadeforsunnydayswmcerra.jpg?v=1644593201"},{"product_id":"skull-shells-ready-to-press-sublimation-and-dtf-transfer","title":"Skull Shells Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39842414690364,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39842414723132,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39842414755900,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39842414788668,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39842414821436,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39842414854204,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/skullshellswmcerra.jpg?v=1644942385"},{"product_id":"summer-days-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Days Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39842415476796,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39842415509564,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39842415542332,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39842415575100,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39842415607868,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39842415640636,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summerdayswmcerra.jpg?v=1644942426"},{"product_id":"summer-soul-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Soul Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":39987017089084,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":39987017121852,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":39987017154620,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":39987017187388,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":39987017220156,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":39987017252924,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":39987017285692,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":39987017318460,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":39987017351228,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":39987017383996,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":39987017416764,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":39987017449532,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":39987017482300,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":39987017515068,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summersoulwmcerra.jpg?v=1644942480"},{"product_id":"summer-vibes-ready-to-press-sublimation-and-dtf-transfer-6","title":"Summer Vibes Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":39987078856764,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":39987078922300,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":39987078987836,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":39987079020604,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":39987079053372,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":39987079086140,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":39987079118908,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":39987079151676,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":39987079184444,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":39987079217212,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":39987079249980,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":39987079282748,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":39987079315516,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":39987079348284,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summervibessinglecolorwmcerra.jpg?v=1644942560"},{"product_id":"summer-vibes-ready-to-press-sublimation-and-dtf-transfer-7","title":"Summer Vibes Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39842419179580,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39842419212348,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39842419245116,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39842419277884,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39842419310652,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39842419343420,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summervibeswmcerra.jpg?v=1644942612"},{"product_id":"sunset-lips-purple-ready-to-press-sublimation-and-dtf-transfer","title":"Sunset Lips Purple Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":39987019415612,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":39987019448380,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":39987019481148,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":39987019513916,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":39987019546684,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":39987019579452,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":39987019612220,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":39987019644988,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":39987019677756,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":39987019710524,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":39987019743292,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":39987019776060,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":39987019808828,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":39987019841596,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/sunsetlipspurplewmcerra.jpg?v=1644942651"},{"product_id":"ying-yang-day-night-ready-to-press-sublimation-and-dtf-transfer","title":"Ying Yang Day Night Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":39987038289980,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":39987038322748,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":39987038355516,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":39987038388284,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":39987038421052,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":39987038453820,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":39987038486588,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":39987038519356,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":39987038552124,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":39987038584892,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":39987038617660,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":39987038650428,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":39987038683196,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":39987038715964,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/yingyangdaynightwmcerra.jpg?v=1644944156"},{"product_id":"beach-please-ready-to-press-sublimation-and-dtf-transfer-3","title":"Beach Please Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":39987010568252,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":39987010732092,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":39987010994236,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":39987011223612,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":39987011420220,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":39987011584060,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":39987011715132,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachpleasewmcerracollab.jpg?v=1645483915"},{"product_id":"float-float-float-ready-to-press-sublimation-and-dtf-transfer","title":"Float Float Float Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40011432230972,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40011432263740,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40011432296508,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40011432329276,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40011432394812,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40011432493116,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40011432558652,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40011432624188,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40011432656956,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40011432722492,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40011432788028,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40011432853564,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40011432919100,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40011432951868,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/floatfloatfloatwmcerracollab.jpg?v=1645484059"},{"product_id":"hakuna-ready-to-press-sublimation-and-dtf-transfer","title":"Hakuna Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39861857452092,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39861857484860,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39861857517628,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39861857550396,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39861857583164,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39861857615932,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/hakunawmcerracollab.jpg?v=1645484112"},{"product_id":"petty-beach-ready-to-press-sublimation-and-dtf-transfer","title":"Petty Beach Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39861940387900,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39861940453436,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39861940486204,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39861940518972,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39861940551740,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39861940584508,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/pettybeachwmcerracollab.jpg?v=1645484406"},{"product_id":"seashell-boobs-ready-to-press-sublimation-and-dtf-transfer","title":"Seashell Boobs Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":39987082526780,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":39987082592316,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":39987082657852,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":39987082723388,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":39987082788924,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":39987082821692,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":39987082854460,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":39987082887228,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":39987082919996,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":39987082952764,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":39987082985532,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":39987083018300,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":39987083051068,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":39987083083836,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/seashellboobswmcerracollab.jpg?v=1645484462"},{"product_id":"bite-me-ready-to-press-sublimation-and-dtf-transfer","title":"Bite Me Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39862100590652,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39862100623420,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39862100656188,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39862100688956,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39862100721724,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39862100754492,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/bitemewmsimplysmoothcollab.jpg?v=1645486408"},{"product_id":"lifes-a-beach-ready-to-press-sublimation-and-dtf-transfer","title":"Lifes a Beach Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40011410309180,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40011410407484,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40011410473020,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40011410505788,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40011410538556,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40011410571324,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40011410604092,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40011410636860,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40011410669628,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40011410702396,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40011410735164,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40011410767932,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40011410800700,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40011410833468,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/lifesabeachwmsimplysmoothcollab.jpg?v=1645487314"},{"product_id":"one-salty-beach-ready-to-press-sublimation-and-dtf-transfer","title":"One Salty Beach Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40047346221116,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40047346253884,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40047346286652,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40047346319420,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40047346352188,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40047346384956,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40047346417724,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40047346450492,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40047346483260,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40047346516028,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40047346548796,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40047346581564,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40047346614332,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40047346647100,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/onesaltybeachsinglecolorwm_91eb9512-e5db-45a4-b4b3-61b8d8920abf.jpg?v=1646331572"},{"product_id":"one-salty-beach-2-ready-to-press-sublimation-and-dtf-transfer","title":"One Salty Beach | 2 Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39895125033020,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39895125065788,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39895125098556,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39895125131324,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39895125164092,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39895125196860,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/onesaltybeachwm.jpg?v=1646331658"},{"product_id":"seagull-french-ready-to-press-sublimation-and-dtf-transfer","title":"Seagull French Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39926273278012,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39926273310780,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39926273343548,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39926273376316,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39926273409084,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39926273441852,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/seagullfrenchfryemdwm.jpg?v=1647383093"},{"product_id":"lazy-days-beach-waves-ready-to-press-sublimation-and-dtf-transfer","title":"Lazy Days Beach Waves Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39927180460092,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39927180492860,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39927180525628,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39927180558396,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39927180591164,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39927180623932,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/lazydaysbeachwavesrtdwm.jpg?v=1647455538"},{"product_id":"chasing-sunsets-ready-to-press-sublimation-and-dtf-transfer-1","title":"Chasing Sunsets Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39968283721788,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39968283754556,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39968283787324,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39968283820092,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39968283852860,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39968283885628,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/chasingsunsetswmcerra.jpg?v=1648919572"},{"product_id":"petty-girl-summer-single-color-ready-to-press-sublimation-and-dtf-transfer","title":"Petty Girl Summer | Single Color Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39968302104636,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39968302137404,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39968302170172,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39968302202940,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39968302235708,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39968302268476,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/pettygirlsummersinglecolorwmcerra.jpg?v=1648919989"},{"product_id":"petty-girl-summerready-to-press-sublimation-and-dtf-transfer","title":"Petty Girl Summer Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":39987018137660,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":39987018235964,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":39987018301500,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":39987018367036,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":39987018432572,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":39987018498108,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":39987018563644,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":39987018596412,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":39987018661948,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":39987018760252,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":39987018793020,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":39987018825788,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":39987018891324,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":39987018956860,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/pettygirlsummerwmcerra.jpg?v=1648920030"},{"product_id":"salty-ready-to-press-sublimation-and-dtf-transfer","title":"Salty Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39968306626620,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39968306659388,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39968306692156,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39968306724924,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39968306757692,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39968306790460,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltywmcerra.jpg?v=1648920061"},{"product_id":"summer-days-beach-waves-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Days Beach Waves Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39968388120636,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39968388153404,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39968388186172,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39968388218940,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39968388251708,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39968388284476,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summerdaysbeachwavessinglecolorwmcerra.jpg?v=1648921853"},{"product_id":"summer-vibes-arrow-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Vibes Arrow Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39968389627964,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39968389660732,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39968389693500,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39968389726268,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39968389759036,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39968389791804,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summervibesarrowwmcerra.jpg?v=1648921889"},{"product_id":"summer-vibes-arrow-single-color-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Vibes Bolt | Single Color Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39968391626812,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39968391659580,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39968391692348,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39968391725116,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39968391757884,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39968391790652,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summervibesboltsinglecolorwmcerra.jpg?v=1648921917"},{"product_id":"summer-vibes-ready-to-press-sublimation-and-dtf-transfer-9","title":"Summer Vibes Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":39968391987260,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":39968392020028,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":39968392052796,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":39968392085564,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":39968392118332,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":39968392151100,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summervibeswmcerra_7638657a-63d9-487d-b569-89e26e8e7710.jpg?v=1648921952"},{"product_id":"aloha-ready-to-press-sublimation-and-dtf-transfer-1","title":"Aloha Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":39996785426492,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":39996785492028,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":39996785557564,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":39996785623100,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":39996785688636,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":39996785754172,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":39996785819708,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/alohawmsc.jpg?v=1649698968"},{"product_id":"beach-babe-ready-to-press-sublimation-and-dtf-transfer-3","title":"Beach Babe Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":40047391014972,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":40047391080508,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":40047391146044,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":40047391211580,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":40047391277116,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":40047391342652,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbabewmcerra.jpg?v=1651298657"},{"product_id":"compass-waves-single-color-ready-to-press-sublimation-and-dtf-transfer","title":"Compass Waves Single Color Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches) \/ Sublimation","offer_id":40047400026172,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3-4 inches) \/ DTF (+2.75)","offer_id":40047400058940,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches) \/ Sublimation","offer_id":40047400091708,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches) \/ DTF (+2.75)","offer_id":40047400124476,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches) \/ Sublimation","offer_id":40047400157244,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches) \/ DTF (+2.75)","offer_id":40047400190012,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches) \/ Sublimation","offer_id":40047400222780,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches) \/ DTF (+2.75)","offer_id":40047400255548,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches) \/ Sublimation","offer_id":40047400288316,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches) \/ DTF (+2.75)","offer_id":40047400321084,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches) \/ Sublimation","offer_id":40047400353852,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches) \/ DTF (+2.75)","offer_id":40047400386620,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/nsewwaveswmcerra.jpg?v=1651298830"},{"product_id":"summer-soul-single-color-ready-to-press-sublimation-and-dtf-transfer","title":"Summer Soul Single Color Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches) \/ Sublimation","offer_id":40047408119868,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3-4 inches) \/ DTF (+2.75)","offer_id":40047408152636,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches) \/ Sublimation","offer_id":40047408185404,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches) \/ DTF (+2.75)","offer_id":40047408218172,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches) \/ Sublimation","offer_id":40047408250940,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches) \/ DTF (+2.75)","offer_id":40047408283708,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches) \/ Sublimation","offer_id":40047408316476,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches) \/ DTF (+2.75)","offer_id":40047408349244,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches) \/ Sublimation","offer_id":40047408382012,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches) \/ DTF (+2.75)","offer_id":40047408414780,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches) \/ Sublimation","offer_id":40047408447548,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches) \/ DTF (+2.75)","offer_id":40047408480316,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summersoulblackwmcerra.jpg?v=1651299081"},{"product_id":"summer-soul-ready-to-press-sublimation-and-dtf-transfer-1","title":"Summer Soul Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches) \/ Sublimation","offer_id":40047409004604,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3-4 inches) \/ DTF (+2.75)","offer_id":40047409037372,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches) \/ Sublimation","offer_id":40047409070140,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches) \/ DTF (+2.75)","offer_id":40047409102908,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches) \/ Sublimation","offer_id":40047409135676,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches) \/ DTF (+2.75)","offer_id":40047409168444,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches) \/ Sublimation","offer_id":40047409201212,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches) \/ DTF (+2.75)","offer_id":40047409233980,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches) \/ Sublimation","offer_id":40047409266748,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches) \/ DTF (+2.75)","offer_id":40047409299516,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches) \/ Sublimation","offer_id":40047409332284,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches) \/ DTF (+2.75)","offer_id":40047409365052,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/summersoulwmcerra_9d114548-d5d2-44d4-92eb-488a29ec4c2a.jpg?v=1651299112"},{"product_id":"ocean-waves-single-color-ready-to-press-sublimation-and-dtf-transfer","title":"Ocean Waves Single Color Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches) \/ Sublimation","offer_id":40047410610236,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3-4 inches) \/ DTF (+2.75)","offer_id":40047410643004,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches) \/ Sublimation","offer_id":40047410675772,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches) \/ DTF (+2.75)","offer_id":40047410708540,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches) \/ Sublimation","offer_id":40047410741308,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches) \/ DTF (+2.75)","offer_id":40047410774076,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches) \/ Sublimation","offer_id":40047410806844,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches) \/ DTF (+2.75)","offer_id":40047410839612,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches) \/ Sublimation","offer_id":40047410872380,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches) \/ DTF (+2.75)","offer_id":40047410905148,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches) \/ Sublimation","offer_id":40047410937916,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches) \/ DTF (+2.75)","offer_id":40047410970684,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/waveswmcerra.jpg?v=1651299143"},{"product_id":"boozy-beach-ready-to-press-sublimation-and-dtf-transfer","title":"Boozy Beach Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40063828557884,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40063828590652,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40063828623420,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40063828656188,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40063828688956,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40063828721724,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40063828754492,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40063828787260,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40063828820028,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40063828852796,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40063828885564,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40063828918332,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40063828951100,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40063828983868,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/IMG_3544.jpg?v=1651726172"},{"product_id":"right-idea-wrong-beach-ready-to-press-sublimation-and-dtf-transfer","title":"Right Idea Wrong Beach Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40063871942716,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40063871975484,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40063872008252,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40063872041020,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40063872073788,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40063872106556,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40063872139324,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40063872172092,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40063872204860,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40063872237628,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40063872270396,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40063872303164,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40063872335932,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40063872368700,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/IMG_3505.jpg?v=1651726533"},{"product_id":"not-all-stars-belong-to-the-sky-ready-to-press-sublimation-and-dtf-transfer","title":"Not all Stars Belong to the Sky Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":40063888982076,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":40063889113148,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":40063889244220,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":40063889375292,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":40063889506364,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":40063889637436,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":40063889768508,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/IMG_3498.jpg?v=1651726725"},{"product_id":"crab-pocket-design-ready-to-press-sublimation-and-dtf-transfer","title":"Crab Pocket Design Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40084696924220,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40084697186364,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40084697415740,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40084697645116,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40084697874492,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40084698103868,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40084698333244,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40084698562620,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40084698791996,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40084699021372,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40084699250748,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40084699480124,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40084699709500,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40084699938876,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/crabpocketdesignwmraisingthree.jpg?v=1652376704"},{"product_id":"crabby-without-sunshine-ready-to-press-sublimation-and-dtf-transfer","title":"Crabby without Sunshine Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40084704854076,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40084705116220,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40084705345596,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40084705574972,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40084705804348,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40084706033724,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40084706263100,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40084706525244,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40084706754620,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40084706983996,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40084707213372,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40084707442748,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40084707672124,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40084707901500,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/crabbywithoutsunshinewmraisingthree.jpg?v=1652376778"},{"product_id":"life-is-too-short-make-waves-ready-to-press-sublimation-and-dtf-transfer","title":"Life is too Short Make Waves Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40084887470140,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40084887699516,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40084887928892,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40084888322108,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40084888584252,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40084888813628,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40084889043004,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40084889272380,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40084889501756,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40084889731132,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40084889960508,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40084890189884,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40084890452028,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40084890681404,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/lifeistooshortmakewaveswmraisingthree.jpg?v=1652381038"},{"product_id":"beach-babe-summer-vibes-and-river-babe-multiple-ready-to-press-sublimation-and-dtf-transfer","title":"Beach Babe, Summer Vibes and River Babe | Multiple Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Summer","offer_id":40085082210364,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ River","offer_id":40148739915836,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ Beach","offer_id":40148739948604,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Summer","offer_id":40085082669116,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ River","offer_id":40148740046908,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Beach","offer_id":40148740079676,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Summer","offer_id":40085083127868,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ River","offer_id":40148740177980,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Beach","offer_id":40148740210748,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Summer","offer_id":40085083586620,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ River","offer_id":40148740309052,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Beach","offer_id":40148740341820,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Summer","offer_id":40085084045372,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ River","offer_id":40148740440124,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Beach","offer_id":40148740472892,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Summer","offer_id":40085084504124,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ River","offer_id":40148740571196,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Beach","offer_id":40148740603964,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Summer","offer_id":40085084995644,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ River","offer_id":40148740702268,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Beach","offer_id":40148740735036,"sku":"","price":2.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbabesummervibesandriverbabewmrockiemultiple.jpg?v=1652384565"},{"product_id":"beach-bum-ready-to-press-sublimation-and-dtf-transfer-2","title":"Beach Bum Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":40085088239676,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":40085088698428,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":40085089157180,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":40085089615932,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":40085090107452,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":40085090566204,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":40085091024956,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachbumwmrockie.jpg?v=1652384657"},{"product_id":"need-a-trip-ready-to-press-sublimation-and-dtf-transfer","title":"Need a Trip Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40087336550460,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40087337009212,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40087337500732,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40087337762876,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40087337992252,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40087338221628,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40087338451004,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40087338680380,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40087338909756,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40087339139132,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40087339368508,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40087339597884,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40087339827260,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40087340056636,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/needatripwmsc.jpg?v=1652454339"},{"product_id":"salty-beach-ready-to-press-sublimation-and-dtf-transfer","title":"Salty Beach Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40087389339708,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40087389569084,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40087389798460,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40087390027836,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40087390257212,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40087390486588,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40087390715964,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40087390945340,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40087391174716,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40087391404092,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40087391633468,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40087391862844,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40087392092220,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40087392321596,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltybeachwmsc.jpg?v=1652455591"},{"product_id":"tan-and-tipsy-ready-to-press-sublimation-and-dtf-transfer","title":"Tan and Tipsy Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40087615373372,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40087615602748,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40087615832124,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40087616061500,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40087616290876,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40087616520252,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40087616749628,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40087616979004,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40087617208380,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40087617437756,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40087617667132,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40087617929276,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40087618158652,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40087618388028,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/tanandtipsywmsc.jpg?v=1652458188"},{"product_id":"beach-is-calling-ready-to-press-sublimation-and-dtf-transfer","title":"Beach is Calling Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40091514077244,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40091514110012,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40091514142780,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40091514175548,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40091514208316,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40091514241084,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40091514273852,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40091514306620,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40091514339388,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40091514372156,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40091514404924,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40091514437692,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40091514470460,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40091514503228,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachiscallingwmcor.jpg?v=1652574745"},{"product_id":"river-babe-beach-and-summer-multiple-ready-to-press-sublimation-and-dtf-transfer","title":"River Babe, Beach and Summer | Multiple Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40096383107132,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40096383139900,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40096383172668,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40096383205436,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40096383238204,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40096383270972,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40096383303740,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40096383336508,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40096383369276,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40096383402044,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40096383434812,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40096383467580,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40096383500348,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40096383533116,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/riverbabebeachandsummermultiplewmrockie.jpg?v=1652717860"},{"product_id":"shady-beach-ready-to-press-sublimation-and-dtf-transfer","title":"Shady Beach Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40096390021180,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40096390053948,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40096390086716,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40096390119484,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40096390152252,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40096390185020,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40096390217788,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40096390250556,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40096390283324,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40096390316092,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40096390348860,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40096390381628,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40096390414396,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40096390447164,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/shadybeachwmrockie.jpg?v=1652718007"},{"product_id":"vacay-mode-ready-to-press-sublimation-and-dtf-transfer-1","title":"Vacay Mode Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40096448512060,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40096448544828,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40096448577596,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40096448610364,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40096448643132,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40096448675900,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40096448708668,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40096448741436,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40096448774204,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40096448806972,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40096448839740,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40096448872508,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40096448905276,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40096448938044,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/vacaymodewmrockie.jpg?v=1652719010"},{"product_id":"salty-ready-to-press-sublimation-and-dtf-transfer-1","title":"Salty Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40096647708732,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40096647741500,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40096647774268,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40096647807036,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40096647839804,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40096647872572,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40096647905340,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40096647938108,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40096647970876,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40096648003644,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40096648036412,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40096648069180,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40096648101948,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40096648134716,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/saltywmcerra_e471df05-24d8-4c96-97db-541d89ff68c3.jpg?v=1652722596"},{"product_id":"beach-days-are-the-best-days-ready-to-press-sublimation-and-dtf-transfer-1","title":"Beach Days are the Best Days Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":40097618722876,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":40097618788412,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":40097618853948,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":40097618919484,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":40097618985020,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":40097619050556,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":40097619116092,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/beachdaysarethebestdayswmsouthernsub.jpg?v=1652739874"},{"product_id":"beach-babe-ready-to-press-sublimation-and-dtf-transfer-4","title":"Beach Babe Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":40197678596156,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":40197678661692,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":40197678727228,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":40197678792764,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":40197678858300,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":40197678923836,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":40197678989372,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/BeachBabe.jpg?v=1655956278"},{"product_id":"summertime-and-sunshine-ready-to-press-sublimation-and-dtf-transfer","title":"Summertime and Sunshine Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40197682430012,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40197682462780,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40197682495548,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40197682528316,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40197682561084,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40197682593852,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40197682626620,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40197682659388,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40197682692156,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40197682724924,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40197682757692,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40197682790460,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40197682823228,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40197682855996,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/Summertime.jpg?v=1655956313"},{"product_id":"beach-babe-sublimation-and-dtf-transfer","title":"Beach Babe Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40270190936124,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40270190968892,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40270191001660,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40270191034428,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40270191067196,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40270191099964,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40270191165500,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40270191198268,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40270191231036,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40270191263804,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40270191296572,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40270191329340,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40270191362108,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40270191394876,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/Beachbabe_62da4d85-b4ff-40d8-976a-a560a3c74ed9.jpg?v=1658274090"},{"product_id":"lets-get-salty-sublimation-and-dtf-transfer","title":"Let's Get Salty Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40270197653564,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40270197686332,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40270197719100,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40270197751868,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40270197784636,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40270197817404,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40270197850172,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40270197882940,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40270197915708,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40270197948476,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40270197981244,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40270198014012,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40270198046780,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40270198079548,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/LET_SGETSALTY.jpg?v=1658274508"},{"product_id":"paradise-city-sublimation-and-dtf-transfer","title":"Paradise City Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall) \/ Sublimation","offer_id":40290071511100,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Mug (3.25 inches tall) \/ DTF","offer_id":40290071543868,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ Sublimation","offer_id":40290071576636,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide) \/ DTF","offer_id":40290071609404,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ Sublimation","offer_id":40290071642172,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall) \/ DTF","offer_id":40290071674940,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ Sublimation","offer_id":40290071707708,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall) \/ DTF","offer_id":40290071740476,"sku":null,"price":5.25,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ Sublimation","offer_id":40290071773244,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall) \/ DTF","offer_id":40290071806012,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ Sublimation","offer_id":40290071838780,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall) \/ DTF","offer_id":40290071871548,"sku":null,"price":5.75,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ Sublimation","offer_id":40290071904316,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall) \/ DTF","offer_id":40290071937084,"sku":null,"price":6.25,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/paradisecity.jpg?v=1659120991"},{"product_id":"ocean-treasures-ready-to-press-sublimation-and-dtf-transfer","title":"Ocean Treasures Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 302 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 8 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3-4 inches)","offer_id":40500238516284,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches)","offer_id":40500238549052,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches)","offer_id":40500238581820,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (9-10 inches)","offer_id":40500238614588,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches)","offer_id":40500238647356,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult Large (12-15 inches)","offer_id":40500238680124,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/IMG_1199.jpg?v=1667965608"},{"product_id":"paradise-on-earth-ready-to-press-sublimation-and-dtf-transfer","title":"Paradise on Earth Ready To Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":44629015888158,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":44629015920926,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":44629015953694,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":44629015986462,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":44629016019230,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":44629016051998,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":44629016084766,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/products\/331739063_940697097154702_8319821719679997732_n.jpg?v=1677911834"},{"product_id":"life-is-a-beach-ready-to-press-sublimation-and-dtf-transfer","title":"Life is a Beach Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":45048053498142,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":45048053530910,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":45048053563678,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":45048053596446,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":45048053629214,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":45048053661982,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":45048053694750,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/files\/lifesabeachwmss.jpg?v=1682889044"},{"product_id":"if-i-cant-wear-flip-flops-i-aint-going-ready-to-press-sublimation-and-dtf-transfer","title":"If I Can't Wear Flip Flops I Aint Going Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":45054290788638,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":45054290821406,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":45054290854174,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":45054290886942,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":45054290919710,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":45054290952478,"sku":null,"price":3.0,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":45054290985246,"sku":null,"price":3.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/files\/flipflopswmkayndi.jpg?v=1683004573"},{"product_id":"lets-float-beaches-ready-to-press-sublimation-and-dtf-transfer","title":"Let's Float Beaches Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":45080651825438,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":45080651858206,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":45080651890974,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":45080651923742,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":45080651956510,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":45080651989278,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":45080652022046,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/files\/letsfloatbeacheswmsc.jpg?v=1683420016"},{"product_id":"ocean-breeze-ready-to-press-sublimation-and-dtf-transfer","title":"Ocean Breeze Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":45080660312350,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":45080660345118,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":45080660377886,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":45080660410654,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":45080660443422,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":45080660476190,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":45080660508958,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/files\/oceanbreezewmsc.jpg?v=1683420310"},{"product_id":"seas-the-day-ready-to-press-sublimation-and-dtf-transfer","title":"Seas the Day Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":45080677351710,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":45080677384478,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":45080677417246,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":45080677450014,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":45080677482782,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":45080677515550,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":45080677548318,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/files\/seasthedaywmsc.jpg?v=1683420650"},{"product_id":"tanned-tatted-and-tipsy-ready-to-press-sublimation-and-dtf-transfer","title":"Tanned, Tatted and Tipsy Ready to Press Sublimation and DTF Transfer","description":"\u003cp\u003e\u003cspan\u003eSublimation is the process in which a special ink is used to print the design and pressed onto a substrate that is either coated with a special coating or material that is 100% polyester. If pressing onto a shirt that isn't 100% polyester the design will have a duller look to it and will wash out some after each wash. Sublimation ink can only stick to polyester fibers which is the reason for the less vibrant image and the washing out a bit after a wash. It is suggested to press at 385 degrees with light pressure for approximately 45 seconds. Ensure you adhere the paper to the substrate to prevent ghosting which is caused when the paper lifts or moves during the transfer process. It is best to rip around the image to remove any excess areas to prevent unseen ink from transferring onto your garment. Transfers will come printed reverse. \u003cbr\u003e\u003cbr\u003eDTF is the process in which designs are printed directly onto a film. The design is able to be applied to almost any substrate\/material. Also, these transfers can go on any color item. Unlike sublimation this process DOES print white. The process is rather simple. To apply you will press the design at 275 degrees for 8 seconds for cotton and 266 degrees for 5 seconds for polyester medium to high pressure. Set item aside and let cool. Once cool peel the film and repress with teflon sheet for 5 seconds. You want to see the texture of the shirt. With these items you will want to wash inside out in cold water and dry on low heat.\u003cbr\u003e\u003cbr\u003eSIZING\u003cbr\u003eMug: 3-4 inches wide\/height\u003cbr\u003eInfant: 5-6 inches wide\/height\u003cbr\u003eToddler: 7-8 inches wide\/height\u003cbr\u003eYouth: 8-10 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult: 8-11 inches wide\/height (printed on a standard 8.5 by 11 inch size paper)\u003cbr\u003eAdult large: 12-15 inches wide\/height (printed on a 13x19 inch paper and proportioned accordingly)\u003cbr\u003eALL HEIGHTS WILL BE BASED ON THE APPROPRIATE PROPORTION FOR THE DESIRED WIDTH\/HEIGHT and paper size only pertains to sublimation not DTF\u003cbr\u003e\u003cbr\u003e***NOTE WHITE DOES NOT PRINT WITH SUBLIMATION***\u003cbr\u003e\u003cbr\u003eYou can also get CUSTOM transfer upon request but design must be print ready! A png with transparent background is required.\u003cbr\u003e\u003cbr\u003eSublimation transfers are usually a turnaround time of approximately 1 business day. Sometimes I am able to ship out same day depending on the time the order is placed. \u003cbr\u003eDTF transfers will now have a processing time of approximately 7-10 business days (could be less but I don't want to put anyone in a situation if production is delayed for some reason or another). Production days will be every Tuesday and Friday. All orders between placed before Tuesday will be on the production list for Tuesday and any order placed on Tuesday to Thursday will now be on Friday's production list. I am trying to organize set days for production to accommodate the volume of orders.\u003cbr\u003e\u003cbr\u003eBULK ORDER PRICING NOW AVAILABLE!\u003cbr\u003eFor those who just can't get enough of these new transfers I have decided to offer bulk pricing. There is a minimum of 25 transfers to qualify for bulk order pricing. The bulk pricing will provide a percentage off your order total (not total with tax and shipping). The discounts with be as follows:\u003cbr\u003e-25 to 60 transfers 10% off use code BULK1\u003cbr\u003e-61 to 99 transfers 15% off use code BULK2\u003cbr\u003e-100+ transfers 20% off use code BULK3\u003cbr\u003eGANG SHEETS ONLY ALLOWED ON A 12X12 AREA (SO YOU CAN PUT HOWEVER MANY ITEMS WILL FIT WITHIN 12X12 INCHES) AND MUST BE CHARGED AS AN ADULT LARGE\u003cbr\u003eIf you images don't fit within the 12x12 you must charge each design individually and use the bulk discount if you order 25 or more\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"coolheatstore","offers":[{"title":"Mug (3.25 inches tall)","offer_id":45666853716254,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Chest Size (3.5 inches wide)","offer_id":45666853749022,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Infant (5-6 inches wide\/tall)","offer_id":45666853781790,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Toddler (7-8 inches wide\/tall)","offer_id":45666853814558,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Youth (8-9.5 inches wide\/tall)","offer_id":45666853847326,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult (8-11 inches wide\/tall)","offer_id":45666853880094,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true},{"title":"Adult xl (12-15 inches wide\/tall)","offer_id":45666853912862,"sku":null,"price":2.5,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/coolheatstore.com\/s\/files\/1\/0271\/3744\/1852\/files\/tannedtattedwmaz.jpg?v=1688357191"}],"url":"https:\/\/coolheatstore.com\/collections\/beach-transfers.oembed","provider":"coolheatstore","version":"1.0","type":"link"}